PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK34704.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family bZIP
Protein Properties Length: 403aa    MW: 44184.7 Da    PI: 6.7534
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK34704.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.53.3e-14231285458
                 XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                  kr+rr+ +NRe+ArrsR+RK++++ e  + v +L  e ++L ++l+ ++ ++++
  KFK34704.1 231 KKRARRMLSNRESARRSRRRKQEQMNEFDTQVGQLRVEHSTLLSRLSDMNHKYDA 285
                 69*****************************************999988877765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1706.1E-10228282No hitNo description
SMARTSM003383.0E-15228292IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.576230284IPR004827Basic-leucine zipper domain
PfamPF001707.1E-12232284IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.82E-10232282No hitNo description
PROSITE patternPS000360235250IPR004827Basic-leucine zipper domain
PfamPF124981.5E-13299341IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000693Biological Processpositive regulation of seed maturation
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 403 aa     Download sequence    Send to blast
MHIVFSVDDL TESFWPVPAP APSPGSTPAP APTVAEGMTR SQSEWAFHRL LKEMSGSDSS  60
PTSNVIERSS PTIQSEQSLS RLEESVDETS DVVEIQKPPQ NHRVDDRANR SRAPSSDTVD  120
PNQYHAILKS KLDLACAAVA RRVGTVKPED SSASGGNQKQ SLPMGAQAQG SVVAQTSPGA  180
SSVGFVPSTS TQKKPDVPVR QTTSLSSRDD SDDDDLDGDT ETADNGDPTD KKRARRMLSN  240
RESARRSRRR KQEQMNEFDT QVGQLRVEHS TLLSRLSDMN HKYDAAAVDN RILRADIETL  300
RTKVKMAEET VKRVTGVNPL HWARPNMGIP FNNTPSSDSS RLPPNSNTIL KAAIPSSAGG  360
APNQRVAERA DFLPEQVNRE GMHNSFAPDS HLYETLPRWN HKH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1230250KKRARRMLSNRESARRSRRRK
2244251RRSRRRKQ
3246251SRRRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3530610.0AK353061.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-20-B05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006403555.10.0hypothetical protein EUTSA_v10010426mg
SwissprotQ9M1G60.0BZP25_ARATH; Basic leucine zipper 25
TrEMBLA0A087GXV20.0A0A087GXV2_ARAAL; Uncharacterized protein
STRINGscaffold_502576.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58482645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54620.11e-171basic leucine zipper 25